Web stats for Intuwiz - intuwiz.ru
Числовое программное управление.
1.67 Rating by ClearWebStats
intuwiz.ru is 1 decade 1 year 8 months old. This website has a #1,178,219 rank in global traffic. It has a .ru as an domain extension. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, intuwiz.ru is SAFE to browse.
Traffic Report of Intuwiz
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Privacy: | Good |
WOT Child Safety: | Excellent |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,178,219 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
83
Siteadvisor Rating
Not Applicable
Where is intuwiz.ru server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | pub-5842975738122497 | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 90.156.201.38)
Ковры интернет-магазин ковров, продажа напольных ковров Carpet-Gold - Москва
- carpet-gold.ru
В нашем интернет-магазине вы можете приобрести ковры различных материалов и расцветок. Приглашаем посмотреть наш каталог ковров. Доставка бесплатно!
Ярославль 7 - интернет портал Ярославля
- yar7.ru
Ярославль 7 - справочник компаний Ярославля, работа в Ярославле, объявления, рейтинг сайтов и др.
Издательство ГРОМ-4 (Москва) – редакция периодических изданий и полиграфические услуги
- grom-media.ru
Редакция СМИ, периодики, книжной продукции. Типография цифровой оперативной полиграфии. Дизайн-студия. Видеостудия.
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 16 Mar 2017 20:25:28 GMT
Content-Type: text/html
Content-Length: 5162
Connection: keep-alive
Keep-Alive: timeout=5
Content-Encoding: gzip
Last-Modified: Tue, 28 Feb 2017 06:03:52 GMT
Accept-Ranges: bytes
ETag: "b13f9a6f8891d21:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/8.0
X-Powered-By: ASP.NET
Status-Code: 200
Status: 200 OK
Date: Thu, 16 Mar 2017 20:25:28 GMT
Content-Type: text/html
Content-Length: 5162
Connection: keep-alive
Keep-Alive: timeout=5
Content-Encoding: gzip
Last-Modified: Tue, 28 Feb 2017 06:03:52 GMT
Accept-Ranges: bytes
ETag: "b13f9a6f8891d21:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/8.0
X-Powered-By: ASP.NET
Domain Information for intuwiz.ru
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
intuwiz.ru | A | 900 |
IP:90.156.201.15 |
intuwiz.ru | A | 900 |
IP:90.156.201.47 |
intuwiz.ru | A | 900 |
IP:90.156.201.111 |
intuwiz.ru | A | 900 |
IP:90.156.201.38 |
intuwiz.ru | NS | 900 |
Target:ns1.masterhost.ru |
intuwiz.ru | NS | 900 |
Target:ns.masterhost.ru |
intuwiz.ru | NS | 900 |
Target:ns2.masterhost.ru |
intuwiz.ru | SOA | 900 |
MNAME:ns1.masterhost.ru RNAME:hostmaster.masterhost.ru Serial:1480094488 Refresh:28800 Retry:7200 Expire:1209600 |
intuwiz.ru | MX | 900 |
Priority:10 Target:mx4.masterhost.ru |
INTUWIZ.ru | AAAA | 893 |
IPV6:2a00:15f8:a000:5:1:12:5:6393 |
INTUWIZ.ru | AAAA | 893 |
IPV6:2a00:15f8:a000:5:1:14:5:6393 |
INTUWIZ.ru | AAAA | 893 |
IPV6:2a00:15f8:a000:5:1:13:5:6393 |
INTUWIZ.ru | AAAA | 893 |
IPV6:2a00:15f8:a000:5:1:11:5:6393 |
Similarly Ranked Websites to Intuwiz
Cheap Flights | Discount Airfare | Airline Tickets | Cheapseats.com
- cheapseats.com
Terri Johnson Creates
- terrijohnsoncreates.com
Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
Full WHOIS Lookup for intuwiz.ru
% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).
domain: INTUWIZ.RU
nserver: ns1.masterhost.ru.
nserver: ns2.masterhost.ru.
nserver: ns.masterhost.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RD-RU
admin-contact: https://cp.mastername.ru/domain_feedback/
created: 2012-08-07T06:45:44Z
paid-till: 2017-08-07T07:45:44Z
free-date: 2017-09-07
source: TCI
Last updated on 2017-03-16T20:21:30Z
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).
domain: INTUWIZ.RU
nserver: ns1.masterhost.ru.
nserver: ns2.masterhost.ru.
nserver: ns.masterhost.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RD-RU
admin-contact: https://cp.mastername.ru/domain_feedback/
created: 2012-08-07T06:45:44Z
paid-till: 2017-08-07T07:45:44Z
free-date: 2017-09-07
source: TCI
Last updated on 2017-03-16T20:21:30Z